HyperAIHyperAI

Command Palette

Search for a command to run...

MAGE: Monoclonal Antibody Gene Generator

Date

3 months ago

Paper URL

www.cell.com

License

Apache 2.0

1. Tutorial Introduction

GitHub Stars

MAGE (Monoclonal Antibody Generator) is a sequence-based protein language model (PLM) published in June 2024 by the IGLAB (Immunogenomics Lab) team at Vanderbilt University Medical Center (VUMC). This model is fine-tuned to generate paired human variable heavy and light chain antibody sequences targeting specific targets. It has been demonstrated that MAGE can generate novel and diverse antibody sequences with experimentally validated binding specificity against SARS-CoV-2, an emerging avian influenza strain H5N1, and respiratory syncytial virus A (RSV-A). Related research findings are available in the following papers. Generation of antigen-specific paired-chain antibodies using large language models .

This tutorial uses a single RTX 5090 card as the resource.

2. Project Examples

3. Operation steps

1. After starting the container, click the API address to enter the Web interface

2. Usage steps

If "Bad Gateway" is displayed, it means the model is initializing. Since the model is large, please wait about 2-3 minutes and refresh the page.

Notice:

Antigen information should be provided in the form of an amino acid sequence, with any signal peptides or transmembrane regions removed.

For example: SARS-CoV-2 Index strain RBD: RVQPTESIVRFPNITNLCPGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFFCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKL PDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFPTNGVGYQPYRVLLSFELLHAPATVCGPKKSTNLVKNKCVNF

Build AI with AI

From idea to launch — accelerate your AI development with free AI co-coding, out-of-the-box environment and best price of GPUs.

AI Co-coding
Ready-to-use GPUs
Best Pricing

HyperAI Newsletters

Subscribe to our latest updates
We will deliver the latest updates of the week to your inbox at nine o'clock every Monday morning
Powered by MailChimp